PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan011646
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family M-type_MADS
Protein Properties Length: 121aa    MW: 13509.1 Da    PI: 8.4715
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S54988284PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.11.3e-191458145
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               k+ie++s  +vtf+kRr  ++KKA+ELS+LC+++ aviifs++gk
  Aan011646 14 KKIESESSLNVTFAKRRPSVMKKANELSTLCGVQSAVIIFSPNGK 58
               68*****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-22666IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.385658IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.16E-21796IPR002100Transcription factor, MADS-box
CDDcd001208.14E-24764No hitNo description
PRINTSPR004044.1E-13828IPR002100Transcription factor, MADS-box
PfamPF003193.5E-201563IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-132843IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-134364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MVRTYTGRKK TENKKIESES SLNVTFAKRR PSVMKKANEL STLCGVQSAV IIFSPNGKSV  60
YSFGDPSPEV LVSGYLEHHS GAQSSQTSEW EEQFQNPQTE ILNTQLNSVL ARLESEQNIT  120
K
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-22AGAMOUS-like 62